Krispy Kreme will now deliver hot donuts
We are absolutely here for this new news.
Getting a dinner delivered to your door is quite serious, but opening the door to a krispy kremepy kreme toasty donut box is another type of indulgence. This just in the Krispy Kreme delivery will be available at the national level.
DepartureFebruary 29All your dreams of delivery of desserts will officially become reality. Soon, there will be no need to leave your house to receive all the donutes covered with fresh ice cubes covered with fresh ice cubes (and perhaps even cream) have to offer.
To take advantage of the Krispy Kreme Delivery Service, all you have to do is have a phone or computer and live near a Krispy Kreme shop. Orders can be placedin line Or via the Krispy Kreme app, so you can have a box of donuts delivered to breakfast without having to change comfortable PJs.
The delivery service will be launched on JONC, Saturday,February 29. The donuts company officially makes thejump From the delivery to the store, so it is logical that the members of the Krispy Kreme team wish to commemorate this big step on a day that comes that every four years. To launch, Krispy Kreme will provide free donuts to dozens of hospitals (within 10 miles of the nearest donut shop) to celebrate the most special deliveries of the day: rails aliases babies born at day LEAP!
RELATED: Born on the day of jump? Here are the 3 best restaurant offers just for you
Pregnant women, doctors, nurses or other maternity hall staff members can post on Instagram or Twitter and tag @krispykreme as well as the use of hashtag#KRISPYKREEEMPECIALDELIVERDELIVERY Having five dozen free donuts delivered to the hospital to help you celebrate the arrival of newborns.
Krispy Kreme has also recently made its debut two new donuts: Donut Fudge cake and Butterfinger donut cake. These two delicacies of blemish are available from now untilMarch 13th, so be sure to include them in your next order of donuts, which you can be delivered directly to your door on this Saturday.
Hungry for more donut content? To verifyThe best donut in each state!
Margaret Cho has entered into renal failure on the set after being in a hurry to lose weight
Here is what happens when you combine coffee with your protein shake, according to experts
